Lineage for d3heio_ (3hei O:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530952Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1530953Protein automated matches [190770] (24 species)
    not a true protein
  7. 1531097Species Human (Homo sapiens) [TaxId:9606] [188939] (9 PDB entries)
  8. 1531109Domain d3heio_: 3hei O: [177444]
    Other proteins in same PDB: d3heib_, d3heid_, d3heif_, d3heih_, d3heij_, d3heil_, d3hein_, d3heip_
    automated match to d1kgya_

Details for d3heio_

PDB Entry: 3hei (more details), 2 Å

PDB Description: ligand recognition by a-class eph receptors: crystal structures of the epha2 ligand-binding domain and the epha2/ephrin-a1 complex
PDB Compounds: (O:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d3heio_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3heio_ b.18.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlldfaaaggelgwlthpygkgwdlmqnimndmpiymysvcnvmsgdqdnwlrtnwvy
rgeaerifielkftvrdcnsfpggasscketfnlyyaesdldygtnfqkrlftkidtiap
deitvssdfearhvklnveersvgpltrkgfylafqdigacvallsvrvyykkc

SCOPe Domain Coordinates for d3heio_:

Click to download the PDB-style file with coordinates for d3heio_.
(The format of our PDB-style files is described here.)

Timeline for d3heio_: