Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188940] (5 PDB entries) |
Domain d3hein_: 3hei N: [177443] Other proteins in same PDB: d3heia_, d3heic_, d3heie_, d3heig_, d3heii_, d3heik_, d3heim_, d3heio_ automated match to d1shwa_ |
PDB Entry: 3hei (more details), 2 Å
SCOPe Domain Sequences for d3hein_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hein_ b.6.1.0 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]} adrhtvfwnssnpkfrnedytihvqlndyvdiicphyedhsvadaameqyilylveheey qlcqpqskdqvrwqcnrpsakhgpeklsekfqrftpftlgkefkeghsyyyiskpihqhe drclrlkvtvki
Timeline for d3hein_: