SCOP 1.69: Domain d1pmt_1: 1pmt 81-201

Lineage for d1pmt_1 (1pmt 81-201)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class beta GST [81357] (3 species)

7. Species Proteus mirabilis [TaxId:584] [47639] (2 PDB entries)

8. Domain d1pmt_1: 1pmt 81-201 [17740]
   Other proteins in same PDB: d1pmt_2

Details for d1pmt_1

PDB Entry: 1pmt, 2.5 Å

PDB Description: glutathione transferase from proteus mirabilis

SCOP Domain Sequences for d1pmt_1:

Sequence; same for both SEQRES and ATOM records:

>d1pmt_1 a.45.1.1 (81-201) Class beta GST {Proteus mirabilis}
nliappkaleryhqiewlnflasevhkgysplfssdtpesylpvvknklkskfvyindvl
skqkcvcgdhftvadaylftlsqwaphvaldltdlshlqdylariaqrpnvhsalvtegl
i

Timeline for d1pmt_1:

• d1pmt_1 first appeared (with stable ids) in SCOP 1.55
  
• d1pmt_1 appears in SCOP 1.67
  
• d1pmt_1 appears in SCOP 1.71
  
• d1pmt_1 appears in the current release, SCOPe 2.08, called d1pmta1