Lineage for d1pmt_1 (1pmt 81-201)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538429Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 538430Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 538431Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 538526Protein Class beta GST [81357] (3 species)
  7. 538533Species Proteus mirabilis [TaxId:584] [47639] (2 PDB entries)
  8. 538534Domain d1pmt_1: 1pmt 81-201 [17740]
    Other proteins in same PDB: d1pmt_2
    complexed with gtt

Details for d1pmt_1

PDB Entry: 1pmt (more details), 2.5 Å

PDB Description: glutathione transferase from proteus mirabilis
PDB Compounds: ( :)

SCOP Domain Sequences for d1pmt_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmt_1 a.45.1.1 (81-201) Class beta GST {Proteus mirabilis}
nliappkaleryhqiewlnflasevhkgysplfssdtpesylpvvknklkskfvyindvl
skqkcvcgdhftvadaylftlsqwaphvaldltdlshlqdylariaqrpnvhsalvtegl
i

SCOP Domain Coordinates for d1pmt_1:

Click to download the PDB-style file with coordinates for d1pmt_1.
(The format of our PDB-style files is described here.)

Timeline for d1pmt_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pmt_2