Lineage for d1a0fa1 (1a0f A:81-201)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1998982Protein Class beta GST [81357] (4 species)
  7. 1998983Species Escherichia coli [TaxId:562] [47638] (3 PDB entries)
  8. 1998986Domain d1a0fa1: 1a0f A:81-201 [17737]
    Other proteins in same PDB: d1a0fa2, d1a0fb2
    complexed with gts

Details for d1a0fa1

PDB Entry: 1a0f (more details), 2.1 Å

PDB Description: crystal structure of glutathione s-transferase from escherichia coli complexed with glutathionesulfonic acid
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1a0fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0fa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]}
qllapvnsisryktiewlnyiatelhkgftplfrpdtpeeykptvraqlekklqyvneal
kdehwicgqrftiadaylftvlrwayavklnleglehiaafmqrmaerpevqdalsaegl
k

SCOPe Domain Coordinates for d1a0fa1:

Click to download the PDB-style file with coordinates for d1a0fa1.
(The format of our PDB-style files is described here.)

Timeline for d1a0fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0fa2