SCOP 1.63: Domain d2fheb1: 2fhe B:81-216

Lineage for d2fheb1 (2fhe B:81-216)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class alpha GST [81349] (6 species)

7. Species Fasciola hepatica [TaxId:6192] [47634] (2 PDB entries)

8. Domain d2fheb1: 2fhe B:81-216 [17725]
   Other proteins in same PDB: d2fhea2, d2fheb2

Details for d2fheb1

PDB Entry: 2fhe, 2.3 Å

PDB Description: fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione

SCOP Domain Sequences for d2fheb1:

Sequence; same for both SEQRES and ATOM records:

>d2fheb1 a.45.1.1 (B:81-216) Class alpha GST {Fasciola hepatica}
igttseerarvsmiegaavdlrqgisrisyqpkfeqlkegylkdlpttmkmwsdflgknp
ylrgtsvshvdfmvyealdairylephcldhfpnlqqfmsriealpsikaymesnrfikw
plngwhaqfgggdapp

Timeline for d2fheb1:

• d2fheb1 first appeared (with stable ids) in SCOP 1.55
  
• d2fheb1 appears in SCOP 1.61
  
• d2fheb1 appears in SCOP 1.65
  
• d2fheb1 appears in the current release, SCOPe 2.08