SCOPe 2.07: Domain d3h3xa_: 3h3x A:

Lineage for d3h3xa_ (3h3x A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)

6. Protein automated matches [190110] (7 species)
   not a true protein

7. Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries)

8. Domain d3h3xa_: 3h3x A: [177169]
   Other proteins in same PDB: d3h3xq_, d3h3xr_, d3h3xs_
   automated match to d1frfs_
   complexed with f3s, fco, gol, mg, ni, sf4; mutant

Details for d3h3xa_

PDB Entry: 3h3x, 2.7 Å

PDB Description: structure of the v74m large subunit mutant of ni-fe hydrogenase in an oxidized state

PDB Compounds: (A:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d3h3xa_:

Sequence; same for both SEQRES and ATOM records:

>d3h3xa_ e.19.1.1 (A:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygel
vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
hpclgcsepdfwdtmtpfyeqg

Timeline for d3h3xa_:

• d3h3xa_ first appeared in SCOPe 2.01
  
• d3h3xa_ appears in SCOPe 2.06
  
• d3h3xa_ appears in the current release, SCOPe 2.08