Lineage for d1frfs_ (1frf S:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624627Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2624628Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2624629Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 2624630Protein Nickel-iron hydrogenase, small subunit [56772] (5 species)
  7. 2624636Species Desulfovibrio fructosovorans [TaxId:878] [56775] (1 PDB entry)
  8. 2624637Domain d1frfs_: 1frf S: [43312]
    Other proteins in same PDB: d1frfl_
    complexed with f3s, fe, mg, ni, sf4

Details for d1frfs_

PDB Entry: 1frf (more details), 2.7 Å

PDB Description: crystal structure of the ni-fe hydrogenase from desulfovibrio fructosovorans
PDB Compounds: (S:) [ni-fe] hydrogenase

SCOPe Domain Sequences for d1frfs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frfs_ e.19.1.1 (S:) Nickel-iron hydrogenase, small subunit {Desulfovibrio fructosovorans [TaxId: 878]}
khrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaagetseaalhea
legkdgyylvvegglptidggqwgmvaghpmietckkaaakakgiicigtcspyggvqka
kpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygelv
hdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqagh
pclgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d1frfs_:

Click to download the PDB-style file with coordinates for d1frfs_.
(The format of our PDB-style files is described here.)

Timeline for d1frfs_:

2624637
d1frfs_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1frfl_