Lineage for d3h1ga_ (3h1g A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158037Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1158038Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1158049Protein CheY protein [52174] (5 species)
  7. 1158115Species Helicobacter pylori [TaxId:85962] [189261] (1 PDB entry)
  8. 1158116Domain d3h1ga_: 3h1g A: [177148]
    automated match to d2chea_
    complexed with mg, so4; mutant

Details for d3h1ga_

PDB Entry: 3h1g (more details), 1.7 Å

PDB Description: crystal structure of chey mutant t84a of helicobacter pylori
PDB Compounds: (A:) Chemotaxis protein cheY homolog

SCOPe Domain Sequences for d3h1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1ga_ c.23.1.1 (A:) CheY protein {Helicobacter pylori [TaxId: 85962]}
mkllvvddsstmrriikntlsrlgyedvleaehgveawekldanadtkvlitdwnmpemn
gldlvkkvrsdsrfkeipiimitaeggkaevitalkagvnnyivkpftpqvlkeklevvl
gtn

SCOPe Domain Coordinates for d3h1ga_:

Click to download the PDB-style file with coordinates for d3h1ga_.
(The format of our PDB-style files is described here.)

Timeline for d3h1ga_: