SCOPe 2.05: Domain d3gsga_: 3gsg A:

Lineage for d3gsga_ (3gsg A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (4 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (97 PDB entries)

8. Domain d3gsga_: 3gsg A: [176963]
   automated match to d1c3ba_
   complexed with dms, gf1, po4

Details for d3gsga_

PDB Entry: 3gsg, 2.1 Å

PDB Description: AmpC beta-lactamase in complex with Fragment-based Inhibitor

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3gsga_:

Sequence; same for both SEQRES and ATOM records:

>d3gsga_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d3gsga_:

• d3gsga_ first appeared in SCOPe 2.01
  
• d3gsga_ appears in SCOPe 2.04
  
• d3gsga_ appears in SCOPe 2.06
  
• d3gsga_ appears in the current release, SCOPe 2.08