Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) different families share similar but non-identical metal-binding sites |
Family c.1.15.3: Xylose isomerase [51665] (2 proteins) |
Protein automated matches [190298] (3 species) not a true protein |
Species Streptomyces rubiginosus [TaxId:1929] [187248] (20 PDB entries) |
Domain d3gnxe_: 3gnx E: [176788] automated match to d1clka_ complexed with mn, xyl |
PDB Entry: 3gnx (more details), 2 Å
SCOPe Domain Sequences for d3gnxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gnxe_ c.1.15.3 (E:) automated matches {Streptomyces rubiginosus [TaxId: 1929]} yqptpedrftfglwtvgwqgrdpfgdatrraldpvesvqrlaelgahgvtfhdddlipfg ssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktirn idlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaiep kpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagklf hidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwas aagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefdv daaaargmaferldqlamdhllgar
Timeline for d3gnxe_: