Lineage for d1guha1 (1guh A:81-222)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48057Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 48058Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 48059Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)
  6. 48063Protein Glutathione S-transferase [47618] (24 species)
  7. 48079Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [47625] (7 PDB entries)
  8. 48084Domain d1guha1: 1guh A:81-222 [17671]
    Other proteins in same PDB: d1guha2, d1guhb2

Details for d1guha1

PDB Entry: 1guh (more details), 2.6 Å

PDB Description: Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the MU and PI class enzymes

SCOP Domain Sequences for d1guha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guha1 a.45.1.1 (A:81-222) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOP Domain Coordinates for d1guha1:

Click to download the PDB-style file with coordinates for d1guha1.
(The format of our PDB-style files is described here.)

Timeline for d1guha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1guha2