Lineage for d1guha2 (1guh A:2-80)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70930Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)
  6. 70934Protein Glutathione S-transferase [52863] (24 species)
  7. 70950Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [52870] (7 PDB entries)
  8. 70955Domain d1guha2: 1guh A:2-80 [32965]
    Other proteins in same PDB: d1guha1, d1guhb1

Details for d1guha2

PDB Entry: 1guh (more details), 2.6 Å

PDB Description: Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the MU and PI class enzymes

SCOP Domain Sequences for d1guha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guha2 c.47.1.5 (A:2-80) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOP Domain Coordinates for d1guha2:

Click to download the PDB-style file with coordinates for d1guha2.
(The format of our PDB-style files is described here.)

Timeline for d1guha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1guha1