Lineage for d1gsdb1 (1gsd B:81-209)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213854Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 213855Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 213856Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 213865Protein Class alpha GST [81349] (6 species)
  7. 213870Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (10 PDB entries)
  8. 213880Domain d1gsdb1: 1gsd B:81-209 [17670]
    Other proteins in same PDB: d1gsda2, d1gsdb2

Details for d1gsdb1

PDB Entry: 1gsd (more details), 2.5 Å

PDB Description: glutathione transferase a1-1 in unliganded form

SCOP Domain Sequences for d1gsdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsdb1 a.45.1.1 (B:81-209) Class alpha GST {Human (Homo sapiens), (a1-1)}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmd

SCOP Domain Coordinates for d1gsdb1:

Click to download the PDB-style file with coordinates for d1gsdb1.
(The format of our PDB-style files is described here.)

Timeline for d1gsdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsdb2