Lineage for d1gsdb2 (1gsd B:2-80)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244778Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 244779Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 244918Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 244927Protein Class alpha GST [81360] (6 species)
  7. 244932Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (10 PDB entries)
  8. 244942Domain d1gsdb2: 1gsd B:2-80 [32964]
    Other proteins in same PDB: d1gsda1, d1gsdb1

Details for d1gsdb2

PDB Entry: 1gsd (more details), 2.5 Å

PDB Description: glutathione transferase a1-1 in unliganded form

SCOP Domain Sequences for d1gsdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsdb2 c.47.1.5 (B:2-80) Class alpha GST {Human (Homo sapiens), (a1-1)}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOP Domain Coordinates for d1gsdb2:

Click to download the PDB-style file with coordinates for d1gsdb2.
(The format of our PDB-style files is described here.)

Timeline for d1gsdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsdb1