Lineage for d3gacd_ (3gac D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1210202Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 1210203Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 1210326Family d.80.1.3: MIF-related [55339] (3 proteins)
  6. 1210335Protein Microphage migration inhibition factor (MIF) [55340] (6 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 1210446Species Plasmodium yoelii [TaxId:73239] [189143] (2 PDB entries)
  8. 1210456Domain d3gacd_: 3gac D: [176463]
    automated match to d1mfia_
    complexed with acy, eno, so4

Details for d3gacd_

PDB Entry: 3gac (more details), 2.1 Å

PDB Description: Structure of mif with HPP
PDB Compounds: (D:) Macrophage migration inhibitory factor-like protein

SCOPe Domain Sequences for d3gacd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gacd_ d.80.1.3 (D:) Microphage migration inhibition factor (MIF) {Plasmodium yoelii [TaxId: 73239]}
pccelitnisipddkaqnalseiedaisnvlgkpvayimsnydyqknlrfsgsnegycfv
rltsigginrsnnssladkitkilsnhlgvkprrvyiefrdcsaqnfafsgslfg

SCOPe Domain Coordinates for d3gacd_:

Click to download the PDB-style file with coordinates for d3gacd_.
(The format of our PDB-style files is described here.)

Timeline for d3gacd_: