SCOPe 2.01: Domain d3g6ua_: 3g6u A:

Lineage for d3g6ua_ (3g6u A:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein automated matches [190314] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188856] (15 PDB entries)

8. Domain d3g6ua_: 3g6u A: [176394]
   automated match to d1glua_
   protein/DNA complex; complexed with zn

Details for d3g6ua_

PDB Entry: 3g6u, 1.9 Å

PDB Description: gr dna-binding domain:fkbp5 16bp complex-49

PDB Compounds: (A:) Glucocorticoid receptor

SCOPe Domain Sequences for d3g6ua_:

Sequence; same for both SEQRES and ATOM records:

>d3g6ua_ g.39.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
shmclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacr
yrkclqagmnlearktk

Timeline for d3g6ua_:

• d3g6ua_ is new in SCOPe 2.01-stable
  
• d3g6ua_ appears in SCOPe 2.02
  
• d3g6ua_ appears in the current release, SCOPe 2.08, called d3g6ua1