SCOPe 2.06: Domain d3g6ta1: 3g6t A:440-514

Lineage for d3g6ta1 (3g6t A:440-514)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein automated matches [190314] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188856] (11 PDB entries)

8. Domain d3g6ta1: 3g6t A:440-514 [176392]
   Other proteins in same PDB: d3g6ta2, d3g6tb2
   automated match to d1glua_
   protein/DNA complex; complexed with zn

Details for d3g6ta1

PDB Entry: 3g6t, 1.9 Å

PDB Description: gr gamma dna-binding domain:fkbp5 16bp complex-34

PDB Compounds: (A:) Glucocorticoid receptor

SCOPe Domain Sequences for d3g6ta1:

Sequence; same for both SEQRES and ATOM records:

>d3g6ta1 g.39.1.2 (A:440-514) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
clvcsdeasgchygvltcgsckvffkravegrqhnylcagrndciidkirrkncpacryr
kclqagmnlearktk

Timeline for d3g6ta1:

• d3g6ta1 first appeared in SCOPe 2.01, called d3g6ta_
  
• d3g6ta1 was called d3g6ta_ in SCOPe 2.05
  
• d3g6ta1 appears in SCOPe 2.07
  
• d3g6ta1 appears in the current release, SCOPe 2.08