SCOPe 2.01: Domain d3g53b_: 3g53 B:

Lineage for d3g53b_ (3g53 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (35 PDB entries)

8. Domain d3g53b_: 3g53 B: [176374]
   automated match to d1nxfa_
   complexed with cmo, hem, lt1

Details for d3g53b_

PDB Entry: 3g53, 1.64 Å

PDB Description: ligand migration and cavities within scapharca dimeric hemoglobin: wild type with co bound to heme and chloropropyl benzene bound to the xe4 cavity

PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d3g53b_:

Sequence; same for both SEQRES and ATOM records:

>d3g53b_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d3g53b_:

• d3g53b_ is new in SCOPe 2.01-stable
  
• d3g53b_ appears in SCOPe 2.02
  
• d3g53b_ appears in the current release, SCOPe 2.08