SCOP 1.69: Domain d4gtua1: 4gtu A:85-217

Lineage for d4gtua1 (4gtu A:85-217)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (7 PDB entries)

8. Domain d4gtua1: 4gtu A:85-217 [17621]
   Other proteins in same PDB: d4gtua2, d4gtub2, d4gtuc2, d4gtud2, d4gtue2, d4gtuf2, d4gtug2, d4gtuh2

Details for d4gtua1

PDB Entry: 4gtu, 3.3 Å

PDB Description: ligand-free homodimeric human glutathione s-transferase m4-4

SCOP Domain Sequences for d4gtua1:

Sequence; same for both SEQRES and ATOM records:

>d4gtua1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens)}
lcgeteeekirvdilenqamdvsnqlarvcyspdfeklkpeyleelptmmqhfsqflgkr
pwfvgdkitfvdflaydvldlhrifepncldafpnlkdfisrfeglekisaymkssrflp
kplytrvavwgnk

Timeline for d4gtua1:

• d4gtua1 first appeared (with stable ids) in SCOP 1.55
  
• d4gtua1 appears in SCOP 1.67
  
• d4gtua1 appears in SCOP 1.71
  
• d4gtua1 appears in the current release, SCOPe 2.08