Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (15 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) |
Protein Class mu GST [81359] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [52867] (7 PDB entries) |
Domain d4gtug2: 4gtu G:1-84 [32921] Other proteins in same PDB: d4gtua1, d4gtub1, d4gtuc1, d4gtud1, d4gtue1, d4gtuf1, d4gtug1, d4gtuh1 |
PDB Entry: 4gtu (more details), 3.3 Å
SCOP Domain Sequences for d4gtug2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gtug2 c.47.1.5 (G:1-84) Class mu GST {Human (Homo sapiens)} smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgahkitqsnailcyiarkhn
Timeline for d4gtug2: