SCOPe 2.01: Domain d3fy8x_: 3fy8 X:

Lineage for d3fy8x_ (3fy8 X:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)

7. Species Staphylococcus aureus [TaxId:1280] [188976] (16 PDB entries)

8. Domain d3fy8x_: 3fy8 X: [176135]
   automated match to d1ddra_
   complexed with i2h, nap

Details for d3fy8x_

PDB Entry: 3fy8, 2.2 Å

PDB Description: crystal structure of staph. aureus dhfr complexed with nadph and ar- 101

PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d3fy8x_:

Sequence; same for both SEQRES and ATOM records:

>d3fy8x_ c.71.1.1 (X:) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

Timeline for d3fy8x_:

• d3fy8x_ is new in SCOPe 2.01-stable
  
• d3fy8x_ appears in SCOPe 2.02
  
• d3fy8x_ appears in the current release, SCOPe 2.08