Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins) |
Protein automated matches [190880] (3 species) not a true protein |
Species Rhodococcus sp. [TaxId:1831] [189207] (5 PDB entries) |
Domain d3fwha_: 3fwh A: [176109] automated match to d1bn6a_ complexed with act, cl, ipa; mutant |
PDB Entry: 3fwh (more details), 1.22 Å
SCOPe Domain Sequences for d3fwha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fwha_ c.69.1.8 (A:) automated matches {Rhodococcus sp. [TaxId: 1831]} seigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrc iapdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnpe rvkgiacmefirpfptwdewpefaretfqafrtadvgreliidqnafiegalpkyvvrpl tevemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqspvpkllfwg tpgvlippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpalhhhh
Timeline for d3fwha_: