SCOPe 2.01: Domain d3frga_: 3frg A:

Lineage for d3frga_ (3frg A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein automated matches [190370] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187208] (9 PDB entries)

8. Domain d3frga_: 3frg A: [176001]
   automated match to d1f0ja_
   complexed with ars, gol, mg, sk4, zn

Details for d3frga_

PDB Entry: 3frg, 1.7 Å

PDB Description: catalytic domain of human phosphodiesterase 4b2b in complex with a quinoline inhibitor

PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d3frga_:

Sequence; same for both SEQRES and ATOM records:

>d3frga_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
isrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfris
sdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaa
ihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrq
tlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcad
lsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivh
plwetwadlvqpdaqdildtlednrnwyqamipqa

Timeline for d3frga_:

• d3frga_ is new in SCOPe 2.01-stable
  
• d3frga_ appears in SCOPe 2.02
  
• d3frga_ appears in the current release, SCOPe 2.08