Lineage for d3fluc1 (3flu C:1-291)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445119Species Neisseria meningitidis [TaxId:491] [188931] (1 PDB entry)
  8. 2445122Domain d3fluc1: 3flu C:1-291 [175897]
    Other proteins in same PDB: d3flua2, d3fluc2, d3flud2
    automated match to d1dhpa_
    complexed with gol, so4

Details for d3fluc1

PDB Entry: 3flu (more details), 2 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis
PDB Compounds: (C:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3fluc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fluc1 c.1.10.0 (C:1-291) automated matches {Neisseria meningitidis [TaxId: 491]}
mlqgslvalitpmnqdgsihyeqlrdlidwhiengtdgivavgttgesatlsveehtavi
eavvkhvakrvpviagtganntveaialsqaaekagadytlsvvpyynkpsqegiyqhfk
tiaeatsipmiiynvpgrtvvsmtndtilrlaeipnivgvkeasgnigsnielinrapeg
fvvlsgddhtalpfmlcgghgvitvaanaapklfadmcraalqgdialarelndrlipiy
dtmfcepspaapkwavsalgrcephvrlplvpltengqakvraalkasgql

SCOPe Domain Coordinates for d3fluc1:

Click to download the PDB-style file with coordinates for d3fluc1.
(The format of our PDB-style files is described here.)

Timeline for d3fluc1: