![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (91 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:491] [188931] (1 PDB entry) |
![]() | Domain d3fluc1: 3flu C:1-291 [175897] Other proteins in same PDB: d3flua2, d3fluc2, d3flud2 automated match to d1dhpa_ complexed with gol, so4 |
PDB Entry: 3flu (more details), 2 Å
SCOPe Domain Sequences for d3fluc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fluc1 c.1.10.0 (C:1-291) automated matches {Neisseria meningitidis [TaxId: 491]} mlqgslvalitpmnqdgsihyeqlrdlidwhiengtdgivavgttgesatlsveehtavi eavvkhvakrvpviagtganntveaialsqaaekagadytlsvvpyynkpsqegiyqhfk tiaeatsipmiiynvpgrtvvsmtndtilrlaeipnivgvkeasgnigsnielinrapeg fvvlsgddhtalpfmlcgghgvitvaanaapklfadmcraalqgdialarelndrlipiy dtmfcepspaapkwavsalgrcephvrlplvpltengqakvraalkasgql
Timeline for d3fluc1: