Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (11 species) not a true protein |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [186756] (3 PDB entries) |
Domain d3fkbd_: 3fkb D: [175852] automated match to d1b4sa_ complexed with edo, gol, mg, tnm, tnv |
PDB Entry: 3fkb (more details), 1.65 Å
SCOPe Domain Sequences for d3fkbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fkbd_ d.58.6.1 (D:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} nkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpffg glvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsds vesanreialwfkpeelltevkpnpnlye
Timeline for d3fkbd_: