Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
Protein automated matches [190054] (10 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [188788] (1 PDB entry) |
Domain d3fcab_: 3fca B: [175682] automated match to d1o58a_ complexed with zn |
PDB Entry: 3fca (more details), 2.15 Å
SCOPe Domain Sequences for d3fcab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fcab_ c.79.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]} mmerligstpivrldsidsrixlkleknnpggsvkdrpalfmildaekrgllkngivept sgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvltpgelgmkgavekale isretgahmlnqfenpynvyshqfttgpeilkqmdyqidafvagvgtggtisgvgrvlkg ffgngvkivavepakspvlsggqpgkhaiqgigagfvpkildrsvidevitvedeeayem arylakkegllvgissganvaaalkvaqklgpdarvvtvapdhaerylsil
Timeline for d3fcab_: