Lineage for d3fazc_ (3faz C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2141796Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2141797Protein automated matches [190781] (41 species)
    not a true protein
  7. 2141824Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [188022] (27 PDB entries)
  8. 2141844Domain d3fazc_: 3faz C: [175632]
    automated match to d1a9oa_
    complexed with nos, so4

Details for d3fazc_

PDB Entry: 3faz (more details), 1.9 Å

PDB Description: Crystal structure of Schistosoma mansoni purine nucleoside phosphorylase in complex with inosine
PDB Compounds: (C:) purine-nucleoside phosphorylase

SCOPe Domain Sequences for d3fazc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fazc_ c.56.2.0 (C:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
esvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqts
vvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaaggl
nrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaee
ngfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavsl
vtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd

SCOPe Domain Coordinates for d3fazc_:

Click to download the PDB-style file with coordinates for d3fazc_.
(The format of our PDB-style files is described here.)

Timeline for d3fazc_: