Lineage for d3falc_ (3fal C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747816Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 1747817Species Human (Homo sapiens) [TaxId:9606] [48511] (34 PDB entries)
    Uniprot P19793 227-458
  8. 1747849Domain d3falc_: 3fal C: [175616]
    Other proteins in same PDB: d3falb_, d3fald_
    automated match to d1lbda_
    protein/DNA complex; complexed with lo2, rea

Details for d3falc_

PDB Entry: 3fal (more details), 2.36 Å

PDB Description: humanRXR alpha & mouse LXR alpha complexed with Retenoic acid and GSK2186
PDB Compounds: (C:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d3falc_:

Sequence, based on SEQRES records: (download)

>d3falc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
sanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewak
riphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvga
ifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayc
khkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemlea

Sequence, based on observed residues (ATOM records): (download)

>d3falc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
sanedmpverileaelavdpvtnicqaadkqlftlvewakriphfselplddqvillrag
wnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdk
telgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpa
lrsiglkcltflmemlea

SCOPe Domain Coordinates for d3falc_:

Click to download the PDB-style file with coordinates for d3falc_.
(The format of our PDB-style files is described here.)

Timeline for d3falc_: