Lineage for d3f5oh_ (3f5o H:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1201078Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1201079Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1201307Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 1201400Protein automated matches [190102] (5 species)
    not a true protein
  7. 1201428Species Human (Homo sapiens) [TaxId:9606] [187682] (2 PDB entries)
  8. 1201436Domain d3f5oh_: 3f5o H: [175485]
    automated match to d2f0xa1
    complexed with cl, coa, p6g, uoc

Details for d3f5oh_

PDB Entry: 3f5o (more details), 1.7 Å

PDB Description: Crystal Structure of hTHEM2(undecan-2-one-CoA) complex
PDB Compounds: (H:) Thioesterase superfamily member 2

SCOPe Domain Sequences for d3f5oh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f5oh_ d.38.1.5 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglta
tlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdlt
nkatgkliaqgrhtkhlg

SCOPe Domain Coordinates for d3f5oh_:

Click to download the PDB-style file with coordinates for d3f5oh_.
(The format of our PDB-style files is described here.)

Timeline for d3f5oh_: