Lineage for d3f0qx_ (3f0q X:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904305Species Staphylococcus aureus [TaxId:273036] [188831] (12 PDB entries)
  8. 2904311Domain d3f0qx_: 3f0q X: [175378]
    automated match to d1dhja_
    complexed with 52v, ndp

Details for d3f0qx_

PDB Entry: 3f0q (more details), 2.08 Å

PDB Description: Staphylococcus aureus dihydrofolate reductase complexed with NADPH and 2,4-Diamino-5-[3-(3-methoxy-5-(2,6-dimethylphenyl)phenyl)but-1-ynyl]-6-methylpyrimidine
PDB Compounds: (X:) Trimethoprim-sensitive dihydrofolate reductase

SCOPe Domain Sequences for d3f0qx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f0qx_ c.71.1.0 (X:) automated matches {Staphylococcus aureus [TaxId: 273036]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d3f0qx_:

Click to download the PDB-style file with coordinates for d3f0qx_.
(The format of our PDB-style files is described here.)

Timeline for d3f0qx_: