SCOPe 2.06: Domain d8gssa1: 8gss A:77-209

Lineage for d8gssa1 (8gss A:77-209)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (63 PDB entries)

8. Domain d8gssa1: 8gss A:77-209 [17521]
   Other proteins in same PDB: d8gssa2, d8gssb2, d8gssc2
   complexed with gsh, mes, so4

Details for d8gssa1

PDB Entry: 8gss, 1.9 Å

PDB Description: Human glutathione S-transferase P1-1, complex with glutathione

PDB Compounds: (A:) glutathione s-transferase p1-1

SCOPe Domain Sequences for d8gssa1:

Sequence; same for both SEQRES and ATOM records:

>d8gssa1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d8gssa1:

• d8gssa1 first appeared (with stable ids) in SCOP 1.55
  
• d8gssa1 appears in SCOPe 2.05
  
• d8gssa1 appears in SCOPe 2.07
  
• d8gssa1 appears in the current release, SCOPe 2.08