Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: IpsF-like [69765] (2 families) forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.5.1: IpsF-like [69766] (3 proteins) automatically mapped to Pfam PF02542 |
Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species) |
Species Escherichia coli K-12 [TaxId:83333] [188969] (5 PDB entries) |
Domain d3erne1: 3ern E:1-156 [175172] Other proteins in same PDB: d3erna2, d3ernb2, d3ernc2, d3ernd2, d3erne2, d3ernf2 automated match to d1h48c_ complexed with car, gpp, so4, zn |
PDB Entry: 3ern (more details), 2.1 Å
SCOPe Domain Sequences for d3erne1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3erne1 d.79.5.1 (E:1-156) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli K-12 [TaxId: 83333]} mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl gchmddvnvkattteklgftgrgegiaceavallik
Timeline for d3erne1: