SCOPe 2.07: Domain d3erna1: 3ern A:1-156

Lineage for d3erna1 (3ern A:1-156)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)

7. Species Escherichia coli K-12 [TaxId:83333] [188969] (5 PDB entries)

8. Domain d3erna1: 3ern A:1-156 [175168]
   Other proteins in same PDB: d3erna2, d3ernb2, d3ernc2, d3ernd2, d3erne2, d3ernf2
   automated match to d1h48c_
   complexed with car, gpp, so4, zn

Details for d3erna1

PDB Entry: 3ern, 2.1 Å

PDB Description: Crystal structure of 2C-methyl-D-erythritol 2,4-clycodiphosphate synthase complexed with AraCMP

PDB Compounds: (A:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3erna1:

Sequence; same for both SEQRES and ATOM records:

>d3erna1 d.79.5.1 (A:1-156) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli K-12 [TaxId: 83333]}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavallik

Timeline for d3erna1:

• d3erna1 first appeared in SCOPe 2.01, called d3erna_
  
• d3erna1 appears in SCOPe 2.06
  
• d3erna1 appears in the current release, SCOPe 2.08