Lineage for d3eqza_ (3eqz A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356404Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1356405Protein automated matches [190131] (48 species)
    not a true protein
  7. 1356460Species Colwellia psychrerythraea [TaxId:167879] [188634] (1 PDB entry)
  8. 1356461Domain d3eqza_: 3eqz A: [175164]
    automated match to d1nxoa_

Details for d3eqza_

PDB Entry: 3eqz (more details), 2.15 Å

PDB Description: crystal structure of a response regulator from colwellia psychrerythraea
PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d3eqza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eqza_ c.23.1.0 (A:) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
lnrvfivdddtltcnllktivepifgnveafqhprafltlslnkqdiiildlmmpdmdgi
evirhlaehkspaslilisgydsgvlhsaetlalscglnvintftkpintevltcfltsl
snrq

SCOPe Domain Coordinates for d3eqza_:

Click to download the PDB-style file with coordinates for d3eqza_.
(The format of our PDB-style files is described here.)

Timeline for d3eqza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3eqzb_