Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein automated matches [190140] (30 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (37 PDB entries) |
Domain d3en3a_: 3en3 A: [175095] automated match to d1ftja_ complexed with kai |
PDB Entry: 3en3 (more details), 2.43 Å
SCOPe Domain Sequences for d3en3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3en3a_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} tvvvttimespyvmykknhemfegndkyegycvdlaseiakhigikykiaivpdgkygar dadtkiwngmvgelvygkaeiaiapltitlvreevidfskpfmslgisimikkgtpiesa edlakqteiaygtldsgstkeffrrskiavyekmwtymrsaepsvftrttaegvarvrks kgkfafllestmneyteqrkpcdtmkvggnldskgygvatpkgsslrtpvnlavlklsea gvldklknkwwydkgec
Timeline for d3en3a_: