Lineage for d3ekta_ (3ekt A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2408657Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2408673Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2408674Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (17 PDB entries)
  8. 2408703Domain d3ekta_: 3ekt A: [175029]
    automated match to d1mt7a_
    complexed with 017, act, po4

Details for d3ekta_

PDB Entry: 3ekt (more details), 1.97 Å

PDB Description: crystal structure of the inhibitor darunavir (drv) in complex with a multi-drug resistant hiv-1 protease variant (l10f/g48v/i54v/v64i/v82a) (refer: flap+ in citation.)
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3ekta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ekta_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrpivtiriggqlkealldtgaddtvleemnlpgkwkpkmivgiggfvkvrqyd
qipieicghkaigtvlvgptpaniigrnlltqigctlnf

SCOPe Domain Coordinates for d3ekta_:

Click to download the PDB-style file with coordinates for d3ekta_.
(The format of our PDB-style files is described here.)

Timeline for d3ekta_: