SCOPe 2.01: Domain d3ekrb_: 3ekr B:

Lineage for d3ekrb_ (3ekr B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein HSP90 [55876] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55878] (53 PDB entries)
   Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223

8. Domain d3ekrb_: 3ekr B: [175028]
   automated match to d1osfa_
   complexed with po4, py9

Details for d3ekrb_

PDB Entry: 3ekr, 2 Å

PDB Description: Dihydroxylphenyl amides as inhibitors of the Hsp90 molecular chaperone

PDB Compounds: (B:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3ekrb_:

Sequence; same for both SEQRES and ATOM records:

>d3ekrb_ d.122.1.1 (B:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadi
smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
hlkedqteyleerrikeivkkhsqfigypitlfvekel

Timeline for d3ekrb_:

• d3ekrb_ is new in SCOPe 2.01-stable
  
• d3ekrb_ appears in SCOPe 2.02
  
• d3ekrb_ appears in the current release, SCOPe 2.08, called d3ekrb1