SCOPe 2.01: Domain d3ejwa_: 3ejw A:

Lineage for d3ejwa_ (3ejw A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)

6. Protein automated matches [190296] (4 species)
   not a true protein

7. Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [188703] (1 PDB entry)

8. Domain d3ejwa_: 3ejw A: [174990]
   automated match to d1tjya_
   complexed with pav

Details for d3ejwa_

PDB Entry: 3ejw, 1.8 Å

PDB Description: crystal structure of the sinorhizobium meliloti ai-2 receptor, smlsrb

PDB Compounds: (A:) SmLsrB

SCOPe Domain Sequences for d3ejwa_:

Sequence; same for both SEQRES and ATOM records:

>d3ejwa_ c.93.1.1 (A:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
enqiafipklvgvgfftsggagavkageevgakvtydgptepsvsgqvqfinnfvnqgyn
alivssvspdglcpalkramergvlvmtwdsdvnpdcrsyyinqgtpeqlggllvdmaae
gvkkekakvaffyssptvtdqnawaeaakakiakehpgweivttqygyndaqkslqtaes
ilqtypdldaiiapdanalpaaaqaaenlkraegvtivgfstpnvmrpyiergtiqrfgl
wdvtqqgkisvfvadhvlkngpmkvgekleipgvgtvevsankvqgydyeadgngiillp
ertvftkenignfdf

Timeline for d3ejwa_:

• d3ejwa_ is new in SCOPe 2.01-stable
  
• d3ejwa_ appears in SCOPe 2.02
  
• d3ejwa_ appears in the current release, SCOPe 2.08