SCOPe 2.06: Domain d3ejja1: 3ejj A:4-148

Lineage for d3ejja1 (3ejj A:4-148)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187941] (5 PDB entries)

8. Domain d3ejja1: 3ejj A:4-148 [174984]
   Other proteins in same PDB: d3ejja2
   automated match to d1hmca_

Details for d3ejja1

PDB Entry: 3ejj, 2.4 Å

PDB Description: structure of m-csf bound to the first three domains of fms

PDB Compounds: (A:) Colony stimulating factor-1

SCOPe Domain Sequences for d3ejja1:

Sequence; same for both SEQRES and ATOM records:

>d3ejja1 a.26.1.2 (A:4-148) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdiide
tmrfkdntpnanaterlqelsnnlnscftkdyeeqnkacvrtfhetplqllekiknffne
tknllekdwniftkncnnsfakcss

Timeline for d3ejja1:

• d3ejja1 first appeared in SCOPe 2.01, called d3ejja_
  
• d3ejja1 was called d3ejja_ in SCOPe 2.05
  
• d3ejja1 appears in SCOPe 2.07
  
• d3ejja1 appears in the current release, SCOPe 2.08