SCOPe 2.06: Domain d3ehya_: 3ehy A:

Lineage for d3ehya_ (3ehy A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (39 PDB entries)
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d3ehya_: 3ehy A: [174943]
   automated match to d1os2a_
   complexed with ca, tbl, zn

Details for d3ehya_

PDB Entry: 3ehy, 1.9 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor (r)-2-(4-methoxyphenylsulfonamido)propanoic acid

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d3ehya_:

Sequence; same for both SEQRES and ATOM records:

>d3ehya_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d3ehya_:

• d3ehya_ first appeared in SCOPe 2.01
  
• d3ehya_ appears in SCOPe 2.05
  
• d3ehya_ appears in SCOPe 2.07
  
• d3ehya_ appears in the current release, SCOPe 2.08