Lineage for d3e5wb_ (3e5w B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199112Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1199113Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1199114Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1199312Protein automated matches [190406] (14 species)
    not a true protein
  7. 1199516Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (17 PDB entries)
  8. 1199530Domain d3e5wb_: 3e5w B: [174679]
    automated match to d1uisa_

Details for d3e5wb_

PDB Entry: 3e5w (more details), 1.71 Å

PDB Description: crystal structure analysis of fp611
PDB Compounds: (B:) Red fluorescent protein eqFP611

SCOPe Domain Sequences for d3e5wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e5wb_ d.22.1.1 (B:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
slikenmrmmvvmegsvngyqfkctgegdgnpymgtqtmrikvveggplpfafdilatsf
mygsktfikhtkgipdffkqsfpegftwervtryedggvftvmqdtsledgclvyhakvt
gvnfpsngavmqkktkgwepstemlypadgglrgycqmalnvdgggylfcsfettyrskk
tdenfkmpgfhfvdhrlerleesdkemfvvqhehavakfcdlpsklgrl

SCOPe Domain Coordinates for d3e5wb_:

Click to download the PDB-style file with coordinates for d3e5wb_.
(The format of our PDB-style files is described here.)

Timeline for d3e5wb_: