![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (5 proteins) |
![]() | Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102923] (6 PDB entries) |
![]() | Domain d3e4ua_: 3e4u A: [174657] automated match to d1r2ba_ |
PDB Entry: 3e4u (more details), 2.1 Å
SCOPe Domain Sequences for d3e4ua_:
Sequence, based on SEQRES records: (download)
>d3e4ua_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} sciqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk cnlsvinldpeinpegfcilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik as
>d3e4ua_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} sciqftrhasdvllnlnrlrsrdiltdvvivveqfrahktvlmacsglfysiftdqlkcn lsvinldeinpegfcilldfmytsrlnlregnimavmatamylqmehvvdtcrkfikas
Timeline for d3e4ua_: