SCOPe 2.06: Domain d3dtma_: 3dtm A:

Lineage for d3dtma_ (3dtm A:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [188520] (1 PDB entry)

8. Domain d3dtma_: 3dtm A: [174219]
   automated match to d1axba_

Details for d3dtma_

PDB Entry: 3dtm, 2 Å

PDB Description: increased folding stability of tem-1 beta-lactamase by in-vitro selection

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3dtma_:

Sequence; same for both SEQRES and ATOM records:

>d3dtma_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 469008]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrseerfpmmstfkvllcgailsrid
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
kgltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltpasrq
qlmdwmeadkvagpllrsvlpagwfiadksgagergsrgivaalgpdgkpsrivviyttg
sqatmdelnrqiaeigaslikhw

Timeline for d3dtma_:

• d3dtma_ first appeared in SCOPe 2.01
  
• d3dtma_ appears in SCOPe 2.05
  
• d3dtma_ appears in SCOPe 2.07
  
• d3dtma_ appears in the current release, SCOPe 2.08