Lineage for d3djxb_ (3djx B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890445Protein automated matches [190061] (6 species)
    not a true protein
  7. 1890448Species Cow (Bos taurus) [TaxId:9913] [186780] (70 PDB entries)
  8. 1890491Domain d3djxb_: 3djx B: [174013]
    automated match to d11baa_
    complexed with c5p

Details for d3djxb_

PDB Entry: 3djx (more details), 1.69 Å

PDB Description: bovine seminal ribonuclease- cytidine 5' phosphate complex
PDB Compounds: (B:) Seminal ribonuclease

SCOPe Domain Sequences for d3djxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3djxb_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

SCOPe Domain Coordinates for d3djxb_:

Click to download the PDB-style file with coordinates for d3djxb_.
(The format of our PDB-style files is described here.)

Timeline for d3djxb_: