Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein automated matches [190061] (4 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [186780] (69 PDB entries) |
Domain d3djqa_: 3djq A: [174001] automated match to d11baa_ complexed with udp |
PDB Entry: 3djq (more details), 1.53 Å
SCOPe Domain Sequences for d3djqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3djqa_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf dasv
Timeline for d3djqa_: