Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Thermoplasma volcanium [TaxId:50339] [188518] (1 PDB entry) |
Domain d3df8a1: 3df8 A:1-106 [173882] Other proteins in same PDB: d3df8a2 automated match to d1yyva1 complexed with act |
PDB Entry: 3df8 (more details), 1.65 Å
SCOPe Domain Sequences for d3df8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df8a1 a.4.5.0 (A:1-106) automated matches {Thermoplasma volcanium [TaxId: 50339]} mlrygdteicidpsesvlhllgkkytmliisvlgngstrqnfndirssipgisstilsrr ikdlidsglverrsgqittyaltekgmnvrnslmpllqyisvldrn
Timeline for d3df8a1: