PDB entry 3df8
View 3df8 on RCSB PDB site
Description: The crystal structure of a possible HxlR family transcriptional factor from Thermoplasma volcanium GSS1
Class: transcription
Keywords: APC89000, HxlR, transcriptional factor, structural genomics, PSI-2, midwest center for structural genomics, MCSG, Protein Structure Initiative, TRANSCRIPTION
Deposited on
2008-06-11, released
2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.173
AEROSPACI score: 0.57
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: possible HxlR family transcriptional factor
Species: Thermoplasma volcanium [TaxId:50339]
Gene: TV1295, TVG1336486
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3df8a1, d3df8a2 - Heterogens: ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3df8A (A:)
snamlrygdteicidpsesvlhllgkkytmliisvlgngstrqnfndirssipgisstil
srrikdlidsglverrsgqittyaltekgmnvrnslmpllqyisvldrngd
Sequence, based on observed residues (ATOM records): (download)
>3df8A (A:)
snamlrygdteicidpsesvlhllgkkytmliisvlgngstrqnfndirssipgisstil
srrikdlidsglverrsgqittyaltekgmnvrnslmpllqyisvldrn