Lineage for d3denb_ (3den B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1147695Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1147696Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1147825Protein Dihydrodipicolinate synthase [51574] (12 species)
  7. 1147848Species Escherichia coli K-12 [TaxId:83333] [188673] (3 PDB entries)
  8. 1147852Domain d3denb_: 3den B: [173873]
    automated match to d1dhpa_
    complexed with gol, k, po4; mutant

Details for d3denb_

PDB Entry: 3den (more details), 2.2 Å

PDB Description: structure of e. coli dhdps mutant y107w
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3denb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3denb_ c.1.10.1 (B:) Dihydrodipicolinate synthase {Escherichia coli K-12 [TaxId: 83333]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpywnrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

SCOPe Domain Coordinates for d3denb_:

Click to download the PDB-style file with coordinates for d3denb_.
(The format of our PDB-style files is described here.)

Timeline for d3denb_: