Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
Protein automated matches [190475] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187400] (65 PDB entries) |
Domain d3d42a_: 3d42 A: [173668] automated match to d1jlna_ complexed with gol, tar |
PDB Entry: 3d42 (more details), 2.46 Å
SCOPe Domain Sequences for d3d42a_:
Sequence, based on SEQRES records: (download)
>d3d42a_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ntprevtlhflrtaghpltrwalqrqppspkqleeeflkipsnfvspedldipghaskdr ykdilpnpqsrvclgraqsqedgdyinanyirgydgkekvyiatqgpmpntvsdfwemvw qeevslivmltqlregkekcvhywpteeetygpfqiriqdmkecpeytvrqltiqyqeer rsvkhilfsawpdhqtpesagpllrlvaeveespetaahpgpivvhssagigrtgcfiat rigcqqlkargevdilgivcqlrldrggmiqtaeqyqflhhtlalyagqlpe
>d3d42a_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ntprevtlhflrtaghpltrwalqrqppspkqleeeflkipsnfvspedldipghaskdr ykdilpnpqsrvclgraqsqedgdyinanyirgydgkekvyiatqgpmpntvsdfwemvw qeevslivmltqlrekcvhywpteeetygpfqiriqdmkecpeytvrqltiqyqeerrsv khilfsawpdhqtpesagpllrlvaeveespetaahpgpivvhssagigrtgcfiatrig cqqlkargevdilgivcqlrldrggmiqtaeqyqflhhtlalyagqlpe
Timeline for d3d42a_: